Lineage for d4r1ub_ (4r1u B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095297Species Medicago truncatula [TaxId:3880] [259991] (7 PDB entries)
  8. 2095331Domain d4r1ub_: 4r1u B: [260953]
    automated match to d3hfsa_
    complexed with act

Details for d4r1ub_

PDB Entry: 4r1u (more details), 2.18 Å

PDB Description: crystal structure of medicago truncatula cinnamoyl-coa reductase
PDB Compounds: (B:) Cinnamoyl CoA reductase

SCOPe Domain Sequences for d4r1ub_:

Sequence, based on SEQRES records: (download)

>d4r1ub_ c.2.1.0 (B:) automated matches {Medicago truncatula [TaxId: 3880]}
dqtvcvtgaggfiaswlvklllergytvrgtvrnpedpknghlkelegarerltlhkvdl
ldlqsiqsvvhgchgvfhtaspvtdnpdemlepavngtknviiasaeakvrrvvftssig
tvymdpntsrdvvvdesywsdlehckntknwycygktvaeqsawdiakenqvdlvvvnpv
vvlgpllqptinastihilkylngaaktyvnatqsyvhvkdvalahllvyetnsasgryi
ccetalhrgevveilakyfpeyplptkcsdeknprvkpykfsnqklkdlgleftpvkqcl
ydtvrslqekghlpipp

Sequence, based on observed residues (ATOM records): (download)

>d4r1ub_ c.2.1.0 (B:) automated matches {Medicago truncatula [TaxId: 3880]}
dqtvcvtgaggfiaswlvklllergytvrgtvrnpedpknghlkelegarerltlhkvdl
ldlqsiqsvvhgchgvfhtasmlepavngtknviiasaeakvrrvvftssigtvymdpnt
srdvvvdesywsdlehckntknwycygktvaeqsawdiakenqvdlvvvnpvvvlgpllq
ptinastihilkylngaaktyvnatqsyvhvkdvalahllvyetnsasgryiccetalhr
gevveilakyfpeyplptkcsdeknprvkpykfsnqklkdlgleftpvkqclydtvrslq
ekghlpipp

SCOPe Domain Coordinates for d4r1ub_:

Click to download the PDB-style file with coordinates for d4r1ub_.
(The format of our PDB-style files is described here.)

Timeline for d4r1ub_: