Lineage for d4p38b_ (4p38 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576689Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1577849Protein automated matches [190085] (43 species)
    not a true protein
  7. 1578002Species Human (Homo sapiens) [TaxId:9606] [186828] (10 PDB entries)
  8. 1578036Domain d4p38b_: 4p38 B: [260937]
    automated match to d4bb6a_
    complexed with 21t, cl, ndp

Details for d4p38b_

PDB Entry: 4p38 (more details), 2.8 Å

PDB Description: human 11beta-hydroxysteroid dehydrogenase type 1 in complex with azd8329
PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d4p38b_:

Sequence, based on SEQRES records: (download)

>d4p38b_ c.2.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvayplvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrwtt
llirnpsrkileelystsynwdrf

Sequence, based on observed residues (ATOM records): (download)

>d4p38b_ c.2.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaas
ahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnfl
syvvltvaalpmlkqsngsivvvsslagkvayplvaaysaskfaldgffssirkeysvsr
vnvsitlcvlglidtetamkavsivhmqaapkeecaleiikggalrqeevyydssrwttl
lirnpsrkileelystsynwdrf

SCOPe Domain Coordinates for d4p38b_:

Click to download the PDB-style file with coordinates for d4p38b_.
(The format of our PDB-style files is described here.)

Timeline for d4p38b_: