SCOPe 2.08: Domain d4pbwd2: 4pbw D:123-226

Lineage for d4pbwd2 (4pbw D:123-226)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)

8. Domain d4pbwd2: 4pbw D:123-226 [260936]
   automated match to d2yd3a2
   complexed with nag

Details for d4pbwd2

PDB Entry: 4pbw, 3.05 Å

PDB Description: crystal structure of chicken receptor protein tyrosine phosphatase sigma in complex with trkc

PDB Compounds: (D:) protein-tyrosine phosphatase crypalpha1 isoform

SCOPe Domain Sequences for d4pbwd2:

Sequence; same for both SEQRES and ATOM records:

>d4pbwd2 b.1.1.0 (D:123-226) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vlredqlppgfpnidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdpstsngr
ikqlrsgglqiesseetdqgkyecvasnsagvrysspanlyvrv

Timeline for d4pbwd2:

• d4pbwd2 first appeared in SCOPe 2.04
  
• d4pbwd2 appears in SCOPe 2.07