Lineage for d4pbwe2 (4pbw E:123-227)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355240Species Chicken (Gallus gallus) [TaxId:9031] [188287] (20 PDB entries)
  8. 2355285Domain d4pbwe2: 4pbw E:123-227 [260935]
    automated match to d2yd3a2
    complexed with nag

Details for d4pbwe2

PDB Entry: 4pbw (more details), 3.05 Å

PDB Description: crystal structure of chicken receptor protein tyrosine phosphatase sigma in complex with trkc
PDB Compounds: (E:) protein-tyrosine phosphatase crypalpha1 isoform

SCOPe Domain Sequences for d4pbwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pbwe2 b.1.1.0 (E:123-227) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vlredqlppgfpnidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdpstsngr
ikqlrsgglqiesseetdqgkyecvasnsagvrysspanlyvrvr

SCOPe Domain Coordinates for d4pbwe2:

Click to download the PDB-style file with coordinates for d4pbwe2.
(The format of our PDB-style files is described here.)

Timeline for d4pbwe2: