![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries) |
![]() | Domain d4pbwf2: 4pbw F:123-225 [260934] automated match to d2yd3a2 complexed with nag |
PDB Entry: 4pbw (more details), 3.05 Å
SCOPe Domain Sequences for d4pbwf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pbwf2 b.1.1.0 (F:123-225) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} vlredqlppgfpnidmgpqlkvvertrtatmlcaasgnpdpeitwfkdflpvdpstsngr ikqlrsgglqiesseetdqgkyecvasnsagvrysspanlyvr
Timeline for d4pbwf2:
![]() Domains from other chains: (mouse over for more information) d4pbwd1, d4pbwd2, d4pbwe1, d4pbwe2 |