SCOPe 2.08: Domain d4pbwe1: 4pbw E:29-122

Lineage for d4pbwe1 (4pbw E:29-122)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)

8. Domain d4pbwe1: 4pbw E:29-122 [260932]
   automated match to d2yd3a1
   complexed with nag

Details for d4pbwe1

PDB Entry: 4pbw, 3.05 Å

PDB Description: crystal structure of chicken receptor protein tyrosine phosphatase sigma in complex with trkc

PDB Compounds: (E:) protein-tyrosine phosphatase crypalpha1 isoform

SCOPe Domain Sequences for d4pbwe1:

Sequence, based on SEQRES records:

>d4pbwe1 b.1.1.0 (E:29-122) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnkkgkkvnsqrfetiefdesaga
vlriqplrtprdeniyecvaqnphgevtvhaklt

Sequence, based on observed residues (ATOM records):

>d4pbwe1 b.1.1.0 (E:29-122) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnvnsqrfetiefdesagavlriq
plrtprdeniyecvaqnphgevtvhaklt

Timeline for d4pbwe1:

• d4pbwe1 first appeared in SCOPe 2.04
  
• d4pbwe1 appears in SCOPe 2.07