Lineage for d4pbwd1 (4pbw D:29-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 2754124Domain d4pbwd1: 4pbw D:29-122 [260931]
    automated match to d2yd3a1
    complexed with nag

Details for d4pbwd1

PDB Entry: 4pbw (more details), 3.05 Å

PDB Description: crystal structure of chicken receptor protein tyrosine phosphatase sigma in complex with trkc
PDB Compounds: (D:) protein-tyrosine phosphatase crypalpha1 isoform

SCOPe Domain Sequences for d4pbwd1:

Sequence, based on SEQRES records: (download)

>d4pbwd1 b.1.1.0 (D:29-122) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnkkgkkvnsqrfetiefdesaga
vlriqplrtprdeniyecvaqnphgevtvhaklt

Sequence, based on observed residues (ATOM records): (download)

>d4pbwd1 b.1.1.0 (D:29-122) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
esppvfikkpvdqigvsggvasfvcqatgdpkprvtwnvnsqrfetiefdesagavlriq
plrtprdeniyecvaqnphgevtvhaklt

SCOPe Domain Coordinates for d4pbwd1:

Click to download the PDB-style file with coordinates for d4pbwd1.
(The format of our PDB-style files is described here.)

Timeline for d4pbwd1: