Lineage for d4ospd1 (4osp D:2-253)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2096019Species Streptomyces fradiae [TaxId:1906] [259879] (1 PDB entry)
  8. 2096023Domain d4ospd1: 4osp D:2-253 [260929]
    Other proteins in same PDB: d4ospb2, d4ospd2
    automated match to d4kwib_
    complexed with 2v4, nap

Details for d4ospd1

PDB Entry: 4osp (more details), 2.25 Å

PDB Description: the crystal structure of urdamycin c-6 ketoreductase domain urdmred with bound nadp and rabelomycin
PDB Compounds: (D:) Oxygenase-reductase

SCOPe Domain Sequences for d4ospd1:

Sequence, based on SEQRES records: (download)

>d4ospd1 c.2.1.0 (D:2-253) automated matches {Streptomyces fradiae [TaxId: 1906]}
gkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvatiekeggrafsv
laelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevtpelfdrlvavn
akapffivqraltlipdggriinissgltrfanpqevayamtkgamdqltlhfakhlgsr
nitvnsvgpgitnngtpvfdnpeavaqmagysvfnrvgevtdvadvvaflagddarwitg
syldasggtllg

Sequence, based on observed residues (ATOM records): (download)

>d4ospd1 c.2.1.0 (D:2-253) automated matches {Streptomyces fradiae [TaxId: 1906]}
gkltgktalvtgssrgigratairlaregalvavhcsrnreaadetvatiekeggrafsv
laelgvpgdvhelflalerglkertdattldilvnnagvmggvapeevtpelfdrlvavn
akapffivqraltlipdggriinissgltrfanpqevayamtkgamdqltlhfakhlgsr
nitvnsvgpgitnpeavaqmagysvfnrvgevtdvadvvaflagddarwitgsyldasgg
tllg

SCOPe Domain Coordinates for d4ospd1:

Click to download the PDB-style file with coordinates for d4ospd1.
(The format of our PDB-style files is described here.)

Timeline for d4ospd1: