![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (14 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries) |
![]() | Domain d4nj9l2: 4nj9 L:108-213 [260923] Other proteins in same PDB: d4nj9l1 automated match to d1tqbc2 complexed with 2m9, zn |
PDB Entry: 4nj9 (more details), 1.95 Å
SCOPe Domain Sequences for d4nj9l2:
Sequence, based on SEQRES records: (download)
>d4nj9l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
>d4nj9l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceatspivksfnrne
Timeline for d4nj9l2: