Lineage for d4nj9l2 (4nj9 L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752643Domain d4nj9l2: 4nj9 L:108-213 [260923]
    Other proteins in same PDB: d4nj9h1, d4nj9h2, d4nj9l1
    automated match to d1tqbc2
    complexed with 2m9, zn

Details for d4nj9l2

PDB Entry: 4nj9 (more details), 1.95 Å

PDB Description: crystal structure of fab 8b10 in complex with mpts
PDB Compounds: (L:) 8B10 light chain

SCOPe Domain Sequences for d4nj9l2:

Sequence, based on SEQRES records: (download)

>d4nj9l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Sequence, based on observed residues (ATOM records): (download)

>d4nj9l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceatspivksfnrne

SCOPe Domain Coordinates for d4nj9l2:

Click to download the PDB-style file with coordinates for d4nj9l2.
(The format of our PDB-style files is described here.)

Timeline for d4nj9l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nj9l1