Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
Species Chicken (Gallus gallus) [TaxId:9031] [53962] (716 PDB entries) Uniprot P00698 |
Domain d4n0jb1: 4n0j B:2-129 [260914] Other proteins in same PDB: d4n0ja2, d4n0jb2 automated match to d3lzta_ complexed with cl, gol, mg, na, t3y |
PDB Entry: 4n0j (more details), 1.9 Å
SCOPe Domain Sequences for d4n0jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n0jb1 d.2.1.2 (B:2-129) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} vfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqinsr wwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdvq awirgcrl
Timeline for d4n0jb1: