SCOPe 2.04: Domain d4n1va_: 4n1v A:

Lineage for d4n1va_ (4n1v A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (5 species)
   not a true protein

7. Species Spiroplasma melliferum [TaxId:570509] [260909] (1 PDB entry)

8. Domain d4n1va_: 4n1v A: [260910]
   automated match to d1owfa_

Details for d4n1va_

PDB Entry: 4n1v, 1.36 Å

PDB Description: structure of dna-binding protein hu from micoplasma spiroplasma melliferum

PDB Compounds: (A:) DNA-binding protein HU-beta

SCOPe Domain Sequences for d4n1va_:

Sequence, based on SEQRES records:

>d4n1va_ a.55.1.0 (A:) automated matches {Spiroplasma melliferum [TaxId: 570509]}
hhmskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavtera
ardgrnpstgetikipasksakfkagkqlktdlnn

Sequence, based on observed residues (ATOM records):

>d4n1va_ a.55.1.0 (A:) automated matches {Spiroplasma melliferum [TaxId: 570509]}
hhmskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavtera
ardgrntgetikipasksakfkagkqlktdlnn

Timeline for d4n1va_:

• d4n1va_ is new in SCOPe 2.04-stable
  
• d4n1va_ appears in SCOPe 2.05
  
• d4n1va_ appears in the current release, SCOPe 2.08, called d4n1va1