| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) ![]() dimer of identical subunits |
| Family a.55.1.0: automated matches [191573] (1 protein) not a true family |
| Protein automated matches [191007] (11 species) not a true protein |
| Species Spiroplasma melliferum [TaxId:570509] [260909] (3 PDB entries) |
| Domain d4n1va1: 4n1v A:1-93 [260910] Other proteins in same PDB: d4n1va2 automated match to d1owfa_ |
PDB Entry: 4n1v (more details), 1.36 Å
SCOPe Domain Sequences for d4n1va1:
Sequence, based on SEQRES records: (download)
>d4n1va1 a.55.1.0 (A:1-93) automated matches {Spiroplasma melliferum [TaxId: 570509]}
mskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavteraar
dgrnpstgetikipasksakfkagkqlktdlnn
>d4n1va1 a.55.1.0 (A:1-93) automated matches {Spiroplasma melliferum [TaxId: 570509]}
mskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavteraar
dgrntgetikipasksakfkagkqlktdlnn
Timeline for d4n1va1: