Lineage for d4n1va1 (4n1v A:1-93)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715207Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2715208Protein automated matches [191007] (11 species)
    not a true protein
  7. 2715235Species Spiroplasma melliferum [TaxId:570509] [260909] (3 PDB entries)
  8. 2715236Domain d4n1va1: 4n1v A:1-93 [260910]
    Other proteins in same PDB: d4n1va2
    automated match to d1owfa_

Details for d4n1va1

PDB Entry: 4n1v (more details), 1.36 Å

PDB Description: structure of dna-binding protein hu from micoplasma spiroplasma melliferum
PDB Compounds: (A:) DNA-binding protein HU-beta

SCOPe Domain Sequences for d4n1va1:

Sequence, based on SEQRES records: (download)

>d4n1va1 a.55.1.0 (A:1-93) automated matches {Spiroplasma melliferum [TaxId: 570509]}
mskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavteraar
dgrnpstgetikipasksakfkagkqlktdlnn

Sequence, based on observed residues (ATOM records): (download)

>d4n1va1 a.55.1.0 (A:1-93) automated matches {Spiroplasma melliferum [TaxId: 570509]}
mskkelaaqiaekftdvlskthaeeitnfvfdhikkalvagkevsiagfgkfavteraar
dgrntgetikipasksakfkagkqlktdlnn

SCOPe Domain Coordinates for d4n1va1:

Click to download the PDB-style file with coordinates for d4n1va1.
(The format of our PDB-style files is described here.)

Timeline for d4n1va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n1va2