Lineage for d4mtdd_ (4mtd D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694744Species Escherichia coli [TaxId:83333] [260606] (3 PDB entries)
  8. 2694749Domain d4mtdd_: 4mtd D: [260908]
    automated match to d2fe3a_
    protein/DNA complex; complexed with zn

Details for d4mtdd_

PDB Entry: 4mtd (more details), 2.5 Å

PDB Description: Zinc Uptake Regulator Complexed With Zinc AND DNA
PDB Compounds: (D:) Zinc uptake regulation protein

SCOPe Domain Sequences for d4mtdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mtdd_ a.4.5.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
ektttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakpp
tvyraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedim
htlaakmgfalrhnvieahglcaacveveac

SCOPe Domain Coordinates for d4mtdd_:

Click to download the PDB-style file with coordinates for d4mtdd_.
(The format of our PDB-style files is described here.)

Timeline for d4mtdd_: