Lineage for d4mteb_ (4mte B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480052Species Escherichia coli [TaxId:83333] [260606] (3 PDB entries)
  8. 1480055Domain d4mteb_: 4mte B: [260907]
    automated match to d2fe3a_
    protein/DNA complex; complexed with zn

Details for d4mteb_

PDB Entry: 4mte (more details), 2.5 Å

PDB Description: zinc uptake regulator complexed with zinc and dna
PDB Compounds: (B:) Zinc uptake regulation protein

SCOPe Domain Sequences for d4mteb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mteb_ a.4.5.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ktttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakppt
vyraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedimh
tlaakmgfalrhnvieahglcaacveveac

SCOPe Domain Coordinates for d4mteb_:

Click to download the PDB-style file with coordinates for d4mteb_.
(The format of our PDB-style files is described here.)

Timeline for d4mteb_: