Lineage for d4mtda_ (4mtd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (76 species)
    not a true protein
  7. 2307320Species Escherichia coli [TaxId:83333] [260606] (3 PDB entries)
  8. 2307326Domain d4mtda_: 4mtd A: [260903]
    automated match to d2fe3a_
    protein/DNA complex; complexed with zn

Details for d4mtda_

PDB Entry: 4mtd (more details), 2.5 Å

PDB Description: Zinc Uptake Regulator Complexed With Zinc AND DNA
PDB Compounds: (A:) Zinc uptake regulation protein

SCOPe Domain Sequences for d4mtda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mtda_ a.4.5.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
tttqellaqaekicaqrnvrltpqrlevlrlmslqdgaisaydlldllreaepqakpptv
yraldflleqgfvhkvestnsyvlchlfdqpthtsamficdrcgavkeecaegvedimht
laakmgfalrhnvieahglcaacveveac

SCOPe Domain Coordinates for d4mtda_:

Click to download the PDB-style file with coordinates for d4mtda_.
(The format of our PDB-style files is described here.)

Timeline for d4mtda_: