Lineage for d4mkka_ (4mkk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131568Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 2131569Species Citrobacter freundii [TaxId:546] [142663] (9 PDB entries)
    Uniprot Q84AR1 2-398
  8. 2131571Domain d4mkka_: 4mkk A: [260901]
    automated match to d3mkja_
    complexed with cl, k, na, pge; mutant

Details for d4mkka_

PDB Entry: 4mkk (more details), 1.45 Å

PDB Description: Crystal structure of C115A mutant L-methionine gamma-lyase from Citrobacter freundii modified by allicine
PDB Compounds: (A:) methionine gamma-lyase

SCOPe Domain Sequences for d4mkka_:

Sequence, based on SEQRES records: (download)

>d4mkka_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]}
sdxrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfaleesgyiytrl
gnpttdalekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygathafls
hsmpkfginvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgal
lvvdntfmspycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkdi
tggxmspfnawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyel
gqrqmslpggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvape
erlkagitdglirlsvgledpediindlehairkat

Sequence, based on observed residues (ATOM records): (download)

>d4mkka_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]}
sdxrtygfntqivhagqqpdpstgalstpifqtstfvfdsaeqgaarfytrlgnpttdal
ekklavlergeaglatasgisaitttlltlcqqgdhivsasaiygathaflshsmpkfgi
nvsfvdaakpeeiraamrpetkvvyietpanptlslvdietvagiahqqgallvvdntfm
spycqqplqlgadivvhsvtkyinghgdviggiivgkqefidqarfvglkditggxmspf
nawltlrgvktlgirmerhcenalkiarfleghpsitrvyypglsshpqyelgqrqmslp
ggiisfeiaggleagrrminsvelcllavslgdtetliqhpasmthspvapeerlkagit
dglirlsvgledpediindlehairkat

SCOPe Domain Coordinates for d4mkka_:

Click to download the PDB-style file with coordinates for d4mkka_.
(The format of our PDB-style files is described here.)

Timeline for d4mkka_: