| Class g: Small proteins [56992] (94 folds) |
| Fold g.53: TAZ domain [57932] (1 superfamily) all-alpha fold; Zn-binding sites are in the loops connecting helices |
Superfamily g.53.1: TAZ domain [57933] (1 family) ![]() automatically mapped to Pfam PF02135 |
| Family g.53.1.1: TAZ domain [57934] (2 proteins) |
| Protein automated matches [254574] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255328] (3 PDB entries) |
| Domain d2mh0b1: 2mh0 B:1723-1812 [260897] Other proteins in same PDB: d2mh0b2 automated match to d2k8fa_ |
PDB Entry: 2mh0 (more details)
SCOPe Domain Sequences for d2mh0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mh0b1 g.53.1.1 (B:1723-1812) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcpic
kqlialaayhakhcqenkcpvpfclnikqk
Timeline for d2mh0b1: