Lineage for d2mh0b1 (2mh0 B:1723-1812)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264747Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 2264748Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
    automatically mapped to Pfam PF02135
  5. 2264749Family g.53.1.1: TAZ domain [57934] (2 proteins)
  6. 2264762Protein automated matches [254574] (2 species)
    not a true protein
  7. 2264763Species Human (Homo sapiens) [TaxId:9606] [255328] (3 PDB entries)
  8. 2264764Domain d2mh0b1: 2mh0 B:1723-1812 [260897]
    Other proteins in same PDB: d2mh0b2
    automated match to d2k8fa_

Details for d2mh0b1

PDB Entry: 2mh0 (more details)

PDB Description: solution nmr structure of the p300 taz2:etad1 complex
PDB Compounds: (B:) Histone acetyltransferase p300

SCOPe Domain Sequences for d2mh0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mh0b1 g.53.1.1 (B:1723-1812) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcpic
kqlialaayhakhcqenkcpvpfclnikqk

SCOPe Domain Coordinates for d2mh0b1:

Click to download the PDB-style file with coordinates for d2mh0b1.
(The format of our PDB-style files is described here.)

Timeline for d2mh0b1: