SCOPe 2.04: Domain d2mh0b_: 2mh0 B:

Lineage for d2mh0b_ (2mh0 B:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.53: TAZ domain [57932] (1 superfamily)
   all-alpha fold; Zn-binding sites are in the loops connecting helices

4. Superfamily g.53.1: TAZ domain [57933] (1 family)
   automatically mapped to Pfam PF02135

5. Family g.53.1.1: TAZ domain [57934] (2 proteins)

6. Protein automated matches [254574] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255328] (2 PDB entries)

8. Domain d2mh0b_: 2mh0 B: [260897]
   automated match to d2k8fa_

Details for d2mh0b_

PDB Entry: 2mh0

PDB Description: solution nmr structure of the p300 taz2:etad1 complex

PDB Compounds: (B:) Histone acetyltransferase p300

SCOPe Domain Sequences for d2mh0b_:

Sequence; same for both SEQRES and ATOM records:

>d2mh0b_ g.53.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsatqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcp
ickqlialaayhakhcqenkcpvpfclnikqk

Timeline for d2mh0b_:

• d2mh0b_ is new in SCOPe 2.04-stable
  
• d2mh0b_ appears in SCOPe 2.05
  
• d2mh0b_ appears in the current release, SCOPe 2.08, called d2mh0b1