SCOPe 2.08: Domain d2mh0b1: 2mh0 B:1723-1812

Lineage for d2mh0b1 (2mh0 B:1723-1812)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.53: TAZ domain [57932] (1 superfamily)
   all-alpha fold; Zn-binding sites are in the loops connecting helices

4. Superfamily g.53.1: TAZ domain [57933] (1 family)
   automatically mapped to Pfam PF02135

5. Family g.53.1.1: TAZ domain [57934] (2 proteins)

6. Protein automated matches [254574] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255328] (3 PDB entries)

8. Domain d2mh0b1: 2mh0 B:1723-1812 [260897]
   Other proteins in same PDB: d2mh0b2
   automated match to d2k8fa_

Details for d2mh0b1

PDB Entry: 2mh0

PDB Description: solution nmr structure of the p300 taz2:etad1 complex

PDB Compounds: (B:) Histone acetyltransferase p300

SCOPe Domain Sequences for d2mh0b1:

Sequence; same for both SEQRES and ATOM records:

>d2mh0b1 g.53.1.1 (B:1723-1812) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcpic
kqlialaayhakhcqenkcpvpfclnikqk

Timeline for d2mh0b1:

• d2mh0b1 first appeared in SCOPe 2.04, called d2mh0b_
  
• d2mh0b1 appears in SCOPe 2.07