SCOPe 2.06: Domain d2mbua1: 2mbu A:4-192

Lineage for d2mbua1 (2mbu A:4-192)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189148] (7 PDB entries)

8. Domain d2mbua1: 2mbu A:4-192 [260896]
   Other proteins in same PDB: d2mbua2
   automated match to d3h93a_
   complexed with 1yo

Details for d2mbua1

PDB Entry: 2mbu

PDB Description: padsba plus mips-0000851 (3-[(2-methylbenzyl)sulfanyl]-4h-1,2,4- triazol-4-amine)

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d2mbua1:

Sequence; same for both SEQRES and ATOM records:

>d2mbua1 c.47.1.0 (A:4-192) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
ddytagkeyvelsspvpvsqpgkievvelfwygcphcyafeptivpwseklpadvhfvrl
palfggiwnvhgqmfltlesmgvehdvhnavfeaihkehkklatpeemadflagkgvdke
kflstynsfaikgqmekakklamayqvtgvptmvvngkyrfdigsaggpeetlkladyli
ekeraaakk

Timeline for d2mbua1:

• d2mbua1 first appeared in SCOPe 2.04, called d2mbua_
  
• d2mbua1 was called d2mbua_ in SCOPe 2.05
  
• d2mbua1 does not appear in SCOPe 2.07