SCOPe 2.06: Domain d4m2xe_: 4m2x E:

Lineage for d4m2xe_ (4m2x E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [230073] (6 PDB entries)

8. Domain d4m2xe_: 4m2x E: [260894]
   automated match to d4klxa_
   complexed with act, ndp, po4, tmq

Details for d4m2xe_

PDB Entry: 4m2x, 2.26 Å

PDB Description: Mycobacterium tuberculosis dihydrofolate reductase complexed with trimetrexate (TMQ)

PDB Compounds: (E:) dihydrofolate reductase

SCOPe Domain Sequences for d4m2xe_:

Sequence; same for both SEQRES and ATOM records:

>d4m2xe_ c.71.1.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

Timeline for d4m2xe_:

• d4m2xe_ first appeared in SCOPe 2.04
  
• d4m2xe_ appears in SCOPe 2.05
  
• d4m2xe_ appears in SCOPe 2.07
  
• d4m2xe_ appears in the current release, SCOPe 2.08