SCOPe 2.04: Domain d1ppb.1: 1ppb L:,H:

Lineage for d1ppb.1 (1ppb L:,H:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (169 PDB entries)
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d1ppb.1: 1ppb L:,H: [26089]
   complexed with 0g6

Details for d1ppb.1

PDB Entry: 1ppb, 1.92 Å

PDB Description: the refined 1.9 angstroms crystal structure of human alpha-thrombin: interaction with d-phe-pro-arg chloromethylketone and significance of the tyr-pro-pro-trp insertion segment

PDB Compounds: (H:) alpha-thrombin (large subunit), (L:) alpha-thrombin (small subunit)

SCOPe Domain Sequences for d1ppb.1:

Sequence; same for both SEQRES and ATOM records:

>g1ppb.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Timeline for d1ppb.1:

• d1ppb.1 first appeared (with stable ids) in SCOP 1.55
  
• d1ppb.1 appears in SCOPe 2.03
  
• d1ppb.1 appears in SCOPe 2.05
  
• d1ppb.1 appears in the current release, SCOPe 2.08