Lineage for d4cdha1 (4cdh A:19-120)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (765 PDB entries)
  8. 2353119Domain d4cdha1: 4cdh A:19-120 [260886]
    automated match to d1hzhh3

Details for d4cdha1

PDB Entry: 4cdh (more details), 2.3 Å

PDB Description: crystallographic structure of the human igg1 alpha 2-6 sialilated fc- fragment
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4cdha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cdha1 b.1.1.2 (A:19-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
styrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d4cdha1:

Click to download the PDB-style file with coordinates for d4cdha1.
(The format of our PDB-style files is described here.)

Timeline for d4cdha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cdha2