SCOPe 2.08: Domain d4cdhb1: 4cdh B:17-120

Lineage for d4cdhb1 (4cdh B:17-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4cdhb1: 4cdh B:17-120 [260884]
   automated match to d1hzhh3

Details for d4cdhb1

PDB Entry: 4cdh, 2.3 Å

PDB Description: crystallographic structure of the human igg1 alpha 2-6 sialilated fc- fragment

PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4cdhb1:

Sequence; same for both SEQRES and ATOM records:

>d4cdhb1 b.1.1.2 (B:17-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d4cdhb1:

• d4cdhb1 first appeared in SCOPe 2.04
  
• d4cdhb1 appears in SCOPe 2.07