Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
Protein automated matches [260878] (2 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [260879] (3 PDB entries) |
Domain d4cdla_: 4cdl A: [260880] automated match to d3t8nf_ complexed with llk |
PDB Entry: 4cdl (more details), 2.5 Å
SCOPe Domain Sequences for d4cdla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cdla_ d.17.4.3 (A:) automated matches {Pseudomonas putida [TaxId: 303]} nlptaqevqglmarfielvdvgdieaivqmyaddatiespfgqppihgreqiaahyrkwl gggklrvyltgpvranhngcgtmllrkewvwngqpcatdvilvmrfdeqgriqteqryws evnlcv
Timeline for d4cdla_: