Lineage for d4cdla_ (4cdl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936379Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2936601Protein automated matches [260878] (1 species)
    not a true protein
  7. 2936602Species Pseudomonas putida [TaxId:303] [260879] (3 PDB entries)
  8. 2936607Domain d4cdla_: 4cdl A: [260880]
    automated match to d3t8nf_
    complexed with llk

Details for d4cdla_

PDB Entry: 4cdl (more details), 2.5 Å

PDB Description: crystal structure of retro-aldolase ra110.4-6 complexed with inhibitor 1-(6-methoxy-2-naphthalenyl)-1,3-butanedione
PDB Compounds: (A:) steroid delta-isomerase

SCOPe Domain Sequences for d4cdla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cdla_ d.17.4.3 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmarfielvdvgdieaivqmyaddatiespfgqppihgreqiaahyrkwl
gggklrvyltgpvranhngcgtmllrkewvwngqpcatdvilvmrfdeqgriqteqryws
evnlcv

SCOPe Domain Coordinates for d4cdla_:

Click to download the PDB-style file with coordinates for d4cdla_.
(The format of our PDB-style files is described here.)

Timeline for d4cdla_: