Lineage for d4ce8c_ (4ce8 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812045Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 1812046Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 1812047Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 1812048Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)
  7. 1812049Species Pseudomonas aeruginosa [TaxId:287] [82029] (11 PDB entries)
    Uniprot Q9HYN5 # PA3361
  8. 1812052Domain d4ce8c_: 4ce8 C: [260877]
    automated match to d1uzva_
    complexed with ca, fuc, so4, ure

Details for d4ce8c_

PDB Entry: 4ce8 (more details), 0.9 Å

PDB Description: perdeuterated pseudomonas aeruginosa lectin ii complex with hydrogenated l-fucose and calcium
PDB Compounds: (C:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d4ce8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ce8c_ b.115.1.1 (C:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d4ce8c_:

Click to download the PDB-style file with coordinates for d4ce8c_.
(The format of our PDB-style files is described here.)

Timeline for d4ce8c_: