Class b: All beta proteins [48724] (176 folds) |
Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) |
Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins) automatically mapped to Pfam PF07472 |
Protein Fucose-binding lectin II (PA-LII) [82028] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [82029] (11 PDB entries) Uniprot Q9HYN5 # PA3361 |
Domain d4ce8c_: 4ce8 C: [260877] automated match to d1uzva_ complexed with ca, fuc, so4, ure |
PDB Entry: 4ce8 (more details), 0.9 Å
SCOPe Domain Sequences for d4ce8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ce8c_ b.115.1.1 (C:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]} atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
Timeline for d4ce8c_: