Lineage for d4wmha_ (4wmh A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338543Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2338544Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2338785Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2338786Protein automated matches [190172] (9 species)
    not a true protein
  7. 2338792Species Human (Homo sapiens) [TaxId:9606] [225276] (7 PDB entries)
  8. 2338807Domain d4wmha_: 4wmh A: [260861]
    automated match to d2rgza_
    complexed with cl

Details for d4wmha_

PDB Entry: 4wmh (more details), 2.5 Å

PDB Description: structure of heme oxygenase-2 containing residues 1-288 lacking the membrane spanning region
PDB Compounds: (A:) Heme oxygenase 2

SCOPe Domain Sequences for d4wmha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wmha_ a.132.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
hpafaplyfpmelhrkealtkdmeyffgenweeqvqcpkaaqkyverihyigqnepellv
ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
lnmktkeriveeankafeynmqifnel

SCOPe Domain Coordinates for d4wmha_:

Click to download the PDB-style file with coordinates for d4wmha_.
(The format of our PDB-style files is described here.)

Timeline for d4wmha_: