SCOPe 2.05: Domain d4wnya_: 4wny A:

Lineage for d4wnya_ (4wny A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (18 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [188500] (2 PDB entries)

8. Domain d4wnya_: 4wny A: [260859]
   automated match to d1mjha_

Details for d4wnya_

PDB Entry: 4wny, 2.25 Å

PDB Description: Crystal structure of a protein from the universal stress protein family from Burkholderia pseudomallei

PDB Compounds: (A:) Universal stress protein

SCOPe Domain Sequences for d4wnya_:

Sequence, based on SEQRES records:

>d4wnya_ c.26.2.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
pgsmysiilvaldgsqtashaldaalelaadaharlvpvyvvdmpvfafdtpgydpsilv
dafreegrrvlddaqarmtrrgvagaprlveveppgedvaerleraareigaslivmgth
grrgvrrlmlgsvaerllrharcpvlmipa

Sequence, based on observed residues (ATOM records):

>d4wnya_ c.26.2.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
pgsmysiilvaldgsqtashaldaalelaadaharlvpvyvvdmfdtpgydpsilvdafr
eegrrvlddaqarmtrrgvagaprlveveedvaerleraareigaslivmgthsvaerll
rharcpvlmipa

Timeline for d4wnya_:

• d4wnya_ first appeared in SCOPe 2.04
  
• d4wnya_ is called d4wnya1 in SCOPe 2.06
  
• d4wnya_ appears in the current release, SCOPe 2.08, called d4wnya1