Lineage for d4wnya_ (4wny A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842253Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1842519Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1842520Protein automated matches [190116] (18 species)
    not a true protein
  7. 1842528Species Burkholderia pseudomallei [TaxId:320372] [188500] (2 PDB entries)
  8. 1842531Domain d4wnya_: 4wny A: [260859]
    automated match to d1mjha_

Details for d4wnya_

PDB Entry: 4wny (more details), 2.25 Å

PDB Description: Crystal structure of a protein from the universal stress protein family from Burkholderia pseudomallei
PDB Compounds: (A:) Universal stress protein

SCOPe Domain Sequences for d4wnya_:

Sequence, based on SEQRES records: (download)

>d4wnya_ c.26.2.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
pgsmysiilvaldgsqtashaldaalelaadaharlvpvyvvdmpvfafdtpgydpsilv
dafreegrrvlddaqarmtrrgvagaprlveveppgedvaerleraareigaslivmgth
grrgvrrlmlgsvaerllrharcpvlmipa

Sequence, based on observed residues (ATOM records): (download)

>d4wnya_ c.26.2.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
pgsmysiilvaldgsqtashaldaalelaadaharlvpvyvvdmfdtpgydpsilvdafr
eegrrvlddaqarmtrrgvagaprlveveedvaerleraareigaslivmgthsvaerll
rharcpvlmipa

SCOPe Domain Coordinates for d4wnya_:

Click to download the PDB-style file with coordinates for d4wnya_.
(The format of our PDB-style files is described here.)

Timeline for d4wnya_: