SCOPe 2.05: Domain d4wgvd_: 4wgv D:

Lineage for d4wgvd_ (4wgv D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)

8. Domain d4wgvd_: 4wgv D: [260855]
   automated match to d2p49b_

Details for d4wgvd_

PDB Entry: 4wgv, 3.1 Å

PDB Description: crystal structure of staphylococcus capitis divalent metal ion transporter (dmt) in complex with nanobody

PDB Compounds: (D:) Camelid antibody fragment, nanobody

SCOPe Domain Sequences for d4wgvd_:

Sequence; same for both SEQRES and ATOM records:

>d4wgvd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnanyad
svkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvtvss

Timeline for d4wgvd_:

• d4wgvd_ first appeared in SCOPe 2.04
  
• d4wgvd_ appears in SCOPe 2.06
  
• d4wgvd_ appears in the current release, SCOPe 2.08