Lineage for d4wgvd_ (4wgv D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (149 PDB entries)
  8. 2347940Domain d4wgvd_: 4wgv D: [260855]
    automated match to d2p49b_

Details for d4wgvd_

PDB Entry: 4wgv (more details), 3.1 Å

PDB Description: crystal structure of staphylococcus capitis divalent metal ion transporter (dmt) in complex with nanobody
PDB Compounds: (D:) Camelid antibody fragment, nanobody

SCOPe Domain Sequences for d4wgvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wgvd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnanyad
svkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvtvss

SCOPe Domain Coordinates for d4wgvd_:

Click to download the PDB-style file with coordinates for d4wgvd_.
(The format of our PDB-style files is described here.)

Timeline for d4wgvd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4wgvb_