Lineage for d4ubsa_ (4ubs A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005884Species Streptomyces avermitilis [TaxId:227882] [260823] (3 PDB entries)
  8. 2005885Domain d4ubsa_: 4ubs A: [260824]
    automated match to d2z36a_
    complexed with dif, hem, peg, pge, po4

Details for d4ubsa_

PDB Entry: 4ubs (more details), 2.2 Å

PDB Description: the crystal structure of cytochrome p450 105d7 from streptomyces avermitilis in complex with diclofenac
PDB Compounds: (A:) Pentalenic acid synthase

SCOPe Domain Sequences for d4ubsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubsa_ a.104.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 227882]}
apvafpqdrtcpydpptaydplregrplsrvslydgrsvwvvtghaaarallsdqrlssd
rtlprfpatterfeavrtrrvallgvddpehrtqrrmlvpsftlkraaalrpriqetvdg
lldameaqgppaelvsafalplpsmvicallgvpyadhdffesqsrrllrgpgiaevqda
raqlddylyalidrkrkepgdgllddliqeqlnrgtvdraelvslatllliaghettanm
islgtftllrhpeqlaelraepglmpaaveellrflsiadgllrvatedievagttirad
egvvfatsvinrdaagfaepdaldwhrsarhhvafgfgihqclgqnlaraemeialgtlf
erlpglrlaapadeipfkpgdtiqgmlelpvtw

SCOPe Domain Coordinates for d4ubsa_:

Click to download the PDB-style file with coordinates for d4ubsa_.
(The format of our PDB-style files is described here.)

Timeline for d4ubsa_: