![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
![]() | Protein automated matches [190890] (7 species) not a true protein |
![]() | Species Megavirus chiliensis [TaxId:1094892] [260821] (1 PDB entry) |
![]() | Domain d4u4ia_: 4u4i A: [260822] automated match to d2k4wa_ |
PDB Entry: 4u4i (more details), 2.2 Å
SCOPe Domain Sequences for d4u4ia_:
Sequence, based on SEQRES records: (download)
>d4u4ia_ b.1.8.0 (A:) automated matches {Megavirus chiliensis [TaxId: 1094892]} ffnvvtaicqldkphdygyaiftqlpdcteiqfhlknlppgkhgchihksgdrrngctsm gphfnpfngvhkdiniqhnhlgdlgnivvnnngecneiicvkylpltgsnqiigrglvih ekeddlgmtnhpdskttgnsgdriacgiiayln
>d4u4ia_ b.1.8.0 (A:) automated matches {Megavirus chiliensis [TaxId: 1094892]} ffnvvtaicqldkphdygyaiftqlpdcteiqfhlknlppgkhgchihksgdrrngctsm gphfnpfnlgdlgnivvnnngecneiicvkylpltgsnqiigrglvihekeddgdriacg iiayln
Timeline for d4u4ia_: