Lineage for d4u4ia_ (4u4i A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031006Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2031581Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2031582Protein automated matches [190890] (7 species)
    not a true protein
  7. 2031602Species Megavirus chiliensis [TaxId:1094892] [260821] (1 PDB entry)
  8. 2031603Domain d4u4ia_: 4u4i A: [260822]
    automated match to d2k4wa_

Details for d4u4ia_

PDB Entry: 4u4i (more details), 2.2 Å

PDB Description: Megavirus chilensis superoxide dismutase
PDB Compounds: (A:) cu/zn superoxide dismutase

SCOPe Domain Sequences for d4u4ia_:

Sequence, based on SEQRES records: (download)

>d4u4ia_ b.1.8.0 (A:) automated matches {Megavirus chiliensis [TaxId: 1094892]}
ffnvvtaicqldkphdygyaiftqlpdcteiqfhlknlppgkhgchihksgdrrngctsm
gphfnpfngvhkdiniqhnhlgdlgnivvnnngecneiicvkylpltgsnqiigrglvih
ekeddlgmtnhpdskttgnsgdriacgiiayln

Sequence, based on observed residues (ATOM records): (download)

>d4u4ia_ b.1.8.0 (A:) automated matches {Megavirus chiliensis [TaxId: 1094892]}
ffnvvtaicqldkphdygyaiftqlpdcteiqfhlknlppgkhgchihksgdrrngctsm
gphfnpfnlgdlgnivvnnngecneiicvkylpltgsnqiigrglvihekeddgdriacg
iiayln

SCOPe Domain Coordinates for d4u4ia_:

Click to download the PDB-style file with coordinates for d4u4ia_.
(The format of our PDB-style files is described here.)

Timeline for d4u4ia_: