| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (7 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries) |
| Domain d4tz2a_: 4tz2 A: [260818] automated match to d3daia_ complexed with 39r, cl, so4, trs |
PDB Entry: 4tz2 (more details), 1.7 Å
SCOPe Domain Sequences for d4tz2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tz2a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
qlceeiqesr
Timeline for d4tz2a_: