Lineage for d4tz2a_ (4tz2 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731536Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1731537Protein automated matches [190615] (7 species)
    not a true protein
  7. 1731541Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)
  8. 1731718Domain d4tz2a_: 4tz2 A: [260818]
    automated match to d3daia_
    complexed with 39r, cl, so4, trs

Details for d4tz2a_

PDB Entry: 4tz2 (more details), 1.7 Å

PDB Description: fragment-based screening of the bromodomain of atad2
PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d4tz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tz2a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
qlceeiqesr

SCOPe Domain Coordinates for d4tz2a_:

Click to download the PDB-style file with coordinates for d4tz2a_.
(The format of our PDB-style files is described here.)

Timeline for d4tz2a_: