Lineage for d4tv6a_ (4tv6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088358Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2088359Protein automated matches [190614] (15 species)
    not a true protein
  7. 2088422Species Staphylococcus aureus [TaxId:426430] [260815] (2 PDB entries)
  8. 2088424Domain d4tv6a_: 4tv6 A: [260816]
    automated match to d3qz6a_
    complexed with oaa

Details for d4tv6a_

PDB Entry: 4tv6 (more details), 2.6 Å

PDB Description: crystal structure of citrate synthase variant sbng e151q
PDB Compounds: (A:) 2-dehydro-3-deoxyglucarate aldolase

SCOPe Domain Sequences for d4tv6a_:

Sequence, based on SEQRES records: (download)

>d4tv6a_ c.1.12.0 (A:) automated matches {Staphylococcus aureus [TaxId: 426430]}
slkhrlnngdsvygifnsipdplmieviaasgydfvvidtehvaindetlahliraaeaa
hiipivrvtavidrdiikvldmgargiivphvkdretvehivklsryypqglrslnggrm
arfgrtplldamemanehimviamiqdvegvmaiddiaqvegldmivegaadlsqslgip
wqtrddqvtshvqhifevvnahgkhfcalpredediakwqaqgvqtfilgddrgkiyrhl
saslatskqkgd

Sequence, based on observed residues (ATOM records): (download)

>d4tv6a_ c.1.12.0 (A:) automated matches {Staphylococcus aureus [TaxId: 426430]}
slkhrlnngdsvygifnsipdplmieviaasgydfvvidtehvaindetlahliraaeaa
hiipivrvtdiikvldmgargiivphvkdretvehivklsryypqglrslhimviamiqd
vegvmaiddiaqvegldmivegaadlsqslgipwqtrddqvtshvqhifevvnahgkhfc
alpredediakwqaqgvqtfilgddrgkiyrhlsaslatskqkgd

SCOPe Domain Coordinates for d4tv6a_:

Click to download the PDB-style file with coordinates for d4tv6a_.
(The format of our PDB-style files is described here.)

Timeline for d4tv6a_: