Lineage for d4tvyb2 (4tvy B:247-337)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686645Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1686646Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1686683Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins)
    automatically mapped to Pfam PF10437
  6. 1686687Protein Two-domain LplA, C-terminal domain [160211] (1 species)
  7. 1686688Species Escherichia coli [TaxId:562] [160212] (5 PDB entries)
    Uniprot P32099 247-337
  8. 1686694Domain d4tvyb2: 4tvy B:247-337 [260814]
    Other proteins in same PDB: d4tvyb1
    automated match to d3a7ra2
    complexed with 37r

Details for d4tvyb2

PDB Entry: 4tvy (more details), 2.15 Å

PDB Description: apo resorufin ligase
PDB Compounds: (B:) Lipoate-protein ligase A

SCOPe Domain Sequences for d4tvyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tvyb2 d.224.1.3 (B:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]}
qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
lqqeceallvdfpeqekelrelsawmagavr

SCOPe Domain Coordinates for d4tvyb2:

Click to download the PDB-style file with coordinates for d4tvyb2.
(The format of our PDB-style files is described here.)

Timeline for d4tvyb2: