Lineage for d4rn6b_ (4rn6 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056594Protein Thrombin [50531] (2 species)
  7. 2056630Species Human (Homo sapiens) [TaxId:9606] [50532] (170 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 2056820Domain d4rn6b_: 4rn6 B: [260811]
    automated match to d3sqhe_
    complexed with 15u; mutant

Details for d4rn6b_

PDB Entry: 4rn6 (more details), 3 Å

PDB Description: Structure of prethrombin-2 mutant s195a bound to the active site inhibitor argatroban
PDB Compounds: (B:) Thrombin heavy chain

SCOPe Domain Sequences for d4rn6b_:

Sequence, based on SEQRES records: (download)

>d4rn6b_ b.47.1.2 (B:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
eadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
anvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdaggpf
vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Sequence, based on observed residues (ATOM records): (download)

>d4rn6b_ b.47.1.2 (B:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
eadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
apsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdaggpfvmkspf
nnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOPe Domain Coordinates for d4rn6b_:

Click to download the PDB-style file with coordinates for d4rn6b_.
(The format of our PDB-style files is described here.)

Timeline for d4rn6b_: