![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Lactobacillus casei [TaxId:321967] [260805] (3 PDB entries) |
![]() | Domain d4rk5a_: 4rk5 A: [260807] automated match to d2o20b_ complexed with act, na |
PDB Entry: 4rk5 (more details), 1.35 Å
SCOPe Domain Sequences for d4rk5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rk5a_ c.93.1.0 (A:) automated matches {Lactobacillus casei [TaxId: 321967]} tgnigvlvsrvtnpffaglfdaierelhahgyqvmitqtyddpeaeerflkqlksreldg vilasveapdrvmavakafpgrvvvvnadvqipgatslvlphyqatrdaldylfnqghrr fayvsggtisgahhgqsrtqafldfmqahqllvaqdllfgqihtakegqavgkqlaslap nvrpdavftnsdevavgvidsllaadvkvpddiavmgyddqpfapfakiplttvhqpvas maaaathellkglgrqvaqdtqptlhlslkirqsa
Timeline for d4rk5a_: