Lineage for d4rk0b_ (4rk0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913364Species Enterococcus faecalis [TaxId:226185] [231906] (2 PDB entries)
  8. 2913366Domain d4rk0b_: 4rk0 B: [260799]
    automated match to d2o20b_
    complexed with rib

Details for d4rk0b_

PDB Entry: 4rk0 (more details), 1.8 Å

PDB Description: crystal structure of laci family transcriptional regulator from enterococcus faecalis v583, target efi-512923, with bound ribose
PDB Compounds: (B:) LacI family sugar-binding transcriptional regulator

SCOPe Domain Sequences for d4rk0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rk0b_ c.93.1.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
ktigvivpditnpffaqlirgiesvlykenfililcnadqdvtreheyltelirrsvdgf
viasseisnqtinetlrakkipfivldqkkaegfsdavltddyrggqlaakhlqeqrheq
vivvmpphapvniqqrlkgfcsvytekvqlietelsktggyqavpeilktestgifaind
eiafglyrglaeagkkipedysiigydnvdmceyvspplttiaqpvfqlgqttatlller
ihqpakdweeqtlpvqlierfstaplk

SCOPe Domain Coordinates for d4rk0b_:

Click to download the PDB-style file with coordinates for d4rk0b_.
(The format of our PDB-style files is described here.)

Timeline for d4rk0b_: