Lineage for d4rk9a_ (4rk9 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163494Species Bacillus licheniformis [TaxId:279010] [260795] (1 PDB entry)
  8. 2163495Domain d4rk9a_: 4rk9 A: [260796]
    automated match to d3jzja_

Details for d4rk9a_

PDB Entry: 4rk9 (more details), 2.15 Å

PDB Description: crystal structure of sugar transporter bl01359 from bacillus licheniformis, target efi-510856, in complex with stachyose
PDB Compounds: (A:) Carbohydrate ABC transporter substrate-binding protein MsmE

SCOPe Domain Sequences for d4rk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rk9a_ c.94.1.0 (A:) automated matches {Bacillus licheniformis [TaxId: 279010]}
vtltmfstmtndsekntlrsiaddfekenegikidisfpgpdyenmlrvkmaandmpdlf
dthgwakirygeytadlkdmdwvkhldpnldpilkdekgkvyaypfnqakdgivynagll
kkyglkppqtldelmhaletikeksngsvipfwfagsdkgalaqfydqlatpllitddrr
nekkalengtfdwsdytllaetfkemqekqlinkdiltakpsqlvelmaqekigftlsvt
sigpdtrevnpdiqlgvmptpavyegdkpswiggerhtvavwkdsehleeakrfiefaaq
pkyvkkiaeatsfpqaltnteaenyyskfydqyeeikiepyfdrvylpsgmwdvmgttgq
ellagtltpkqvsekmkqeysrlq

SCOPe Domain Coordinates for d4rk9a_:

Click to download the PDB-style file with coordinates for d4rk9a_.
(The format of our PDB-style files is described here.)

Timeline for d4rk9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4rk9b_