SCOPe 2.08: Domain d4rk0a_: 4rk0 A:

Lineage for d4rk0a_ (4rk0 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [231906] (2 PDB entries)

8. Domain d4rk0a_: 4rk0 A: [260794]
   automated match to d2o20b_
   complexed with rib

Details for d4rk0a_

PDB Entry: 4rk0, 1.8 Å

PDB Description: crystal structure of laci family transcriptional regulator from enterococcus faecalis v583, target efi-512923, with bound ribose

PDB Compounds: (A:) LacI family sugar-binding transcriptional regulator

SCOPe Domain Sequences for d4rk0a_:

Sequence; same for both SEQRES and ATOM records:

>d4rk0a_ c.93.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
sktigvivpditnpffaqlirgiesvlykenfililcnadqdvtreheyltelirrsvdg
fviasseisnqtinetlrakkipfivldqkkaegfsdavltddyrggqlaakhlqeqrhe
qvivvmpphapvniqqrlkgfcsvytekvqlietelsktggyqavpeilktestgifain
deiafglyrglaeagkkipedysiigydnvdmceyvspplttiaqpvfqlgqttatllle
rihqpakdweeqtlpvqlierfstaplk

Timeline for d4rk0a_:

• d4rk0a_ first appeared in SCOPe 2.04
  
• d4rk0a_ appears in SCOPe 2.07