SCOPe 2.08: Domain d4rhab_: 4rha B:

Lineage for d4rhab_ (4rha B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (14 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [260790] (1 PDB entry)

8. Domain d4rhab_: 4rha B: [260791]
   automated match to d4erha_
   complexed with acy, mpd, so4

Details for d4rhab_

PDB Entry: 4rha, 1.75 Å

PDB Description: structure of the c-terminal domain of outer-membrane protein ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s

PDB Compounds: (B:) outer membrane protein a

SCOPe Domain Sequences for d4rhab_:

Sequence; same for both SEQRES and ATOM records:

>d4rhab_ d.79.7.0 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
vqtkhftlksdvlfnfnkstlkpegqqaldqlysqlsnldpkdgsvvvlgftdrigsday
nqglsekraqsvvdyliskgipsdkisargmgesnpvtgntcdnvkpraalidclapdrr
veievkg

Timeline for d4rhab_:

• d4rhab_ first appeared in SCOPe 2.04
  
• d4rhab_ appears in SCOPe 2.07