| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
| Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
| Protein automated matches [195455] (14 species) not a true protein |
| Species Salmonella enterica [TaxId:99287] [260790] (1 PDB entry) |
| Domain d4rhab_: 4rha B: [260791] automated match to d4erha_ complexed with acy, mpd, so4 |
PDB Entry: 4rha (more details), 1.75 Å
SCOPe Domain Sequences for d4rhab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rhab_ d.79.7.0 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
vqtkhftlksdvlfnfnkstlkpegqqaldqlysqlsnldpkdgsvvvlgftdrigsday
nqglsekraqsvvdyliskgipsdkisargmgesnpvtgntcdnvkpraalidclapdrr
veievkg
Timeline for d4rhab_: