Lineage for d4qtya1 (4qty A:29-277)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2100992Family c.17.1.1: Caspase catalytic domain [52130] (8 protein domains)
  6. 2100993Protein Apopain (caspase-3, cpp32) [52131] (1 species)
  7. 2100994Species Human (Homo sapiens) [TaxId:9606] [52132] (28 PDB entries)
  8. 2101006Domain d4qtya1: 4qty A:29-277 [260762]
    Other proteins in same PDB: d4qtya2
    automated match to d2j30a_
    complexed with azi, na

Details for d4qtya1

PDB Entry: 4qty (more details), 1.6 Å

PDB Description: caspase-3 e190a
PDB Compounds: (A:) Caspase-3

SCOPe Domain Sequences for d4qtya1:

Sequence, based on SEQRES records: (download)

>d4qtya1 c.17.1.1 (A:29-277) Apopain (caspase-3, cpp32) {Human (Homo sapiens) [TaxId: 9606]}
sgisldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnk
ndltreeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrc
rsltgkpklfiiqacrgteldcgietdsgvdddmachkipvaadflyaystapgyyswrn
skdgswfiqslcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsm
ltkelyfyh

Sequence, based on observed residues (ATOM records): (download)

>d4qtya1 c.17.1.1 (A:29-277) Apopain (caspase-3, cpp32) {Human (Homo sapiens) [TaxId: 9606]}
sgisldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnk
ndltreeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrc
rsltgkpklfiiqacrgteldcgiethkipvaadflyaystapgyyswrnskdgswfiqs
lcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfyh

SCOPe Domain Coordinates for d4qtya1:

Click to download the PDB-style file with coordinates for d4qtya1.
(The format of our PDB-style files is described here.)

Timeline for d4qtya1: