Lineage for d4qo1a_ (4qo1 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2355917Domain d4qo1a_: 4qo1 A: [260761]
    Other proteins in same PDB: d4qo1b_
    automated match to d4heme_
    protein/DNA complex; complexed with zn

Details for d4qo1a_

PDB Entry: 4qo1 (more details), 1.92 Å

PDB Description: p53 DNA binding domain in complex with Nb139
PDB Compounds: (A:) Nb139 Nanobody against the DNA-binding domain of p53

SCOPe Domain Sequences for d4qo1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qo1a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasertfstyamgwfrqapgrereflaqinwsgtttyya
esvkdrttisrdnakntvylemnnlnaddtgiyfcaahpqrgwgstlgwtywgqgtqvtv
ssggggs

SCOPe Domain Coordinates for d4qo1a_:

Click to download the PDB-style file with coordinates for d4qo1a_.
(The format of our PDB-style files is described here.)

Timeline for d4qo1a_: