SCOPe 2.07: Domain d4qo1a_: 4qo1 A:

Lineage for d4qo1a_ (4qo1 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)

8. Domain d4qo1a_: 4qo1 A: [260761]
   Other proteins in same PDB: d4qo1b_
   automated match to d4heme_
   protein/DNA complex; complexed with zn

Details for d4qo1a_

PDB Entry: 4qo1, 1.92 Å

PDB Description: p53 DNA binding domain in complex with Nb139

PDB Compounds: (A:) Nb139 Nanobody against the DNA-binding domain of p53

SCOPe Domain Sequences for d4qo1a_:

Sequence; same for both SEQRES and ATOM records:

>d4qo1a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasertfstyamgwfrqapgrereflaqinwsgtttyya
esvkdrttisrdnakntvylemnnlnaddtgiyfcaahpqrgwgstlgwtywgqgtqvtv
ssggggs

Timeline for d4qo1a_:

• d4qo1a_ first appeared in SCOPe 2.04
  
• d4qo1a_ appears in SCOPe 2.06
  
• d4qo1a_ appears in the current release, SCOPe 2.08