| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
| Domain d4qo1a_: 4qo1 A: [260761] Other proteins in same PDB: d4qo1b_ automated match to d4heme_ protein/DNA complex; complexed with zn |
PDB Entry: 4qo1 (more details), 1.92 Å
SCOPe Domain Sequences for d4qo1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qo1a_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasertfstyamgwfrqapgrereflaqinwsgtttyya
esvkdrttisrdnakntvylemnnlnaddtgiyfcaahpqrgwgstlgwtywgqgtqvtv
ssggggs
Timeline for d4qo1a_: