Lineage for d4qp0a_ (4qp0 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095871Species Rhizomucor miehei [TaxId:4839] [256971] (7 PDB entries)
  8. 2095879Domain d4qp0a_: 4qp0 A: [260759]
    automated match to d1qnra_
    complexed with so4

Details for d4qp0a_

PDB Entry: 4qp0 (more details), 2.3 Å

PDB Description: crystal structure analysis of the endo-1,4-beta-mannanase from rhizomucor miehei
PDB Compounds: (A:) endo-beta-mannanase

SCOPe Domain Sequences for d4qp0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qp0a_ c.1.8.0 (A:) automated matches {Rhizomucor miehei [TaxId: 4839]}
sfvqtsgpqftldgkpfyfegtnayylmtsdqsnvkqvfsdmkslglpvvrtwlfnlgsd
svwfqqwdsssnkmvindnsdtglgridyiiqqaasqdikliftlnnnwedyggmdyyvk
nfggtyhddfytntemidsfkeyishvlnrensltgvkykddptifgweianeprcvgsg
dfpassncsttvttawikeiseyiksidsnhlvavgdegffnrkgesdyeynggsgmdfd
ailalssidfgtfhlypeawskgtdsswsvqwikdhaaaqadadkpvimeeyglstdalr
vaqypvwqgtvededlaadafwqiavpcstmdgfgicasdndiattvtnhadamakk

SCOPe Domain Coordinates for d4qp0a_:

Click to download the PDB-style file with coordinates for d4qp0a_.
(The format of our PDB-style files is described here.)

Timeline for d4qp0a_: