Lineage for d4qbbc_ (4qbb C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2173267Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2173268Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2173703Family d.3.1.2: FMDV leader protease [54037] (2 proteins)
    automatically mapped to Pfam PF05408
  6. 2173719Protein automated matches [254558] (2 species)
    not a true protein
  7. 2173722Species Foot-and-mouth disease virus [TaxId:73482] [260753] (1 PDB entry)
  8. 2173725Domain d4qbbc_: 4qbb C: [260754]
    automated match to d1qola_
    complexed with e69, k, po4

Details for d4qbbc_

PDB Entry: 4qbb (more details), 1.6 Å

PDB Description: structure of the foot-and-mouth disease virus leader proteinase in complex with inhibitor (n~2~-[(3s)-4-({(2r)-1-[(4-carbamimidamidobutyl)amino]-4-methyl-1-oxopentan-2-yl}amino)-3-hydroxy-4-oxobutanoyl]-l-arginyl-l-prolinamide)
PDB Compounds: (C:) Leader protease

SCOPe Domain Sequences for d4qbbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qbbc_ d.3.1.2 (C:) automated matches {Foot-and-mouth disease virus [TaxId: 73482]}
meltlyngekktfysrpnnhdncwlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydq

SCOPe Domain Coordinates for d4qbbc_:

Click to download the PDB-style file with coordinates for d4qbbc_.
(The format of our PDB-style files is described here.)

Timeline for d4qbbc_: