Lineage for d4po5b_ (4po5 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689358Species Synechocystis sp. [TaxId:1111708] [193921] (2 PDB entries)
  8. 2689359Domain d4po5b_: 4po5 B: [260744]
    Other proteins in same PDB: d4po5a1, d4po5a2, d4po5c1, d4po5c2, d4po5e1, d4po5e2
    automated match to d3dbjb_
    complexed with cyc, so4

Details for d4po5b_

PDB Entry: 4po5 (more details), 1.75 Å

PDB Description: Crystal structure of allophycocyanin B from Synechocystis PCC 6803
PDB Compounds: (B:) allophycocyanin beta chain

SCOPe Domain Sequences for d4po5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4po5b_ a.1.1.3 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mqdaitavinsadvqgkyldgaamdklksyfasgelrvraasvisanaativkeavaksl
lysdvtrpggnmyttrryaacirdldyylryatyamlagdasildervlnglketynslg
vpisstvqaiqaikevtaslvgadagkemgvyldyicsgls

SCOPe Domain Coordinates for d4po5b_:

Click to download the PDB-style file with coordinates for d4po5b_.
(The format of our PDB-style files is described here.)

Timeline for d4po5b_: