Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (23 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [193921] (2 PDB entries) |
Domain d4po5b_: 4po5 B: [260744] Other proteins in same PDB: d4po5a1, d4po5a2, d4po5c1, d4po5c2, d4po5e1, d4po5e2 automated match to d3dbjb_ complexed with cyc, so4 |
PDB Entry: 4po5 (more details), 1.75 Å
SCOPe Domain Sequences for d4po5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4po5b_ a.1.1.3 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]} mqdaitavinsadvqgkyldgaamdklksyfasgelrvraasvisanaativkeavaksl lysdvtrpggnmyttrryaacirdldyylryatyamlagdasildervlnglketynslg vpisstvqaiqaikevtaslvgadagkemgvyldyicsgls
Timeline for d4po5b_: