SCOPe 2.08: Domain d4powa_: 4pow A:

Lineage for d4powa_ (4pow A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [260526] (10 PDB entries)

8. Domain d4powa_: 4pow A: [260742]
   automated match to d2m8ca_
   complexed with edo, op1

Details for d4powa_

PDB Entry: 4pow, 1.55 Å

PDB Description: Structure of the PBP NocT in complex with pyronopaline

PDB Compounds: (A:) Nopaline-binding periplasmic protein

SCOPe Domain Sequences for d4powa_:

Sequence; same for both SEQRES and ATOM records:

>d4powa_ c.94.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yksitiategsyapynfkdaggkligfdidlgndlckrmnieckfveqawdgiipsltag
rydaimaamgiqparekviafsrpylltpmtflttadspllktqvaienlpldnitpeqk
aeldkftkifegvkfgvqagtsheafmkqmmpsvqistydtidnvvmdlkagridaslas
vsflkpltdkpdnkdlkmfgprmtgglfgkgvgvgirkedadlkalfdkaidaaiadgtv
qklsqqwfgydasp

Timeline for d4powa_:

• d4powa_ first appeared in SCOPe 2.04
  
• d4powa_ appears in SCOPe 2.07